Protein Info for EX28DRAFT_2684 in Enterobacter asburiae PDN3

Annotation: Methyltransferase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 23 to 152 (130 residues), 66.1 bits, E=1.8e-21
• PF13489: Methyltransf_23
  • amino acids 33 to 183 (151 residues), 62.2 bits, E=2.9e-20
• PF05175: MTS
  • amino acids 41 to 147 (107 residues), 30.9 bits, E=1.2e-10
• PF07021: MetW
  • amino acids 45 to 138 (94 residues), 21.1 bits, E=1.2e-07
• PF05148: Methyltransf_8
  • amino acids 46 to 157 (112 residues), 29.2 bits, E=5e-10
• PF13847: Methyltransf_31
  • amino acids 47 to 150 (104 residues), 86.3 bits, E=1.2e-27
• PF03848: TehB
  • amino acids 47 to 151 (105 residues), 27.9 bits, E=9.2e-10
• PF03141: Methyltransf_29
  • amino acids 48 to 146 (99 residues), 24.6 bits, E=5.5e-09
• PF13649: Methyltransf_25
  • amino acids 49 to 142 (94 residues), 90.6 bits, E=5.3e-29
• PF08241: Methyltransf_11
  • amino acids 50 to 146 (97 residues), 99.5 bits, E=8.4e-32
• PF08242: Methyltransf_12
  • amino acids 50 to 144 (95 residues), 62.9 bits, E=2.3e-20

Best Hits

KEGG orthology group: None (inferred from 90% identity to enc:ECL_01009)

Predicted SEED Role

"SAM-dependent methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (257 amino acids)

>EX28DRAFT_2684 Methyltransferase domain (Enterobacter asburiae PDN3)
MTTTRSHHDNVEKQFGSQASAYLSSAVHASGRDLVRLGERLAAFPQAHVLDLGCGAGHAS
FAAAQQVAHVTAYDLSSQMLDVVAEAARTKGLDNIDTRQGYAESLPFDDASFEVVISRYS
AHHWHDVGQALREVKRVLKPGGIFIIMDVMSPGHPVRNIWLQTVEALRDTSHVQNYASGE
WLSFITEAGLIARALITDRLPLEFSSWIARMRTPEALSQAIRLYQESASAEVKAYFELQE
DGSFTSDTIMAEAQKAG