Protein Info for EX28DRAFT_2671 in Enterobacter asburiae PDN3

Annotation: ABC-type dipeptide/oligopeptide/nickel transport systems, permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 155 to 172 (18 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details PF12911: OppC_N" amino acids 19 to 66 (48 residues), 44.9 bits, see alignment 8.8e-16 PF00528: BPD_transp_1" amino acids 108 to 289 (182 residues), 110.4 bits, see alignment E=8.8e-36

Best Hits

Swiss-Prot: 46% identical to GSID_SHIFL: Glutathione transport system permease protein GsiD (gsiD) from Shigella flexneri

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 99% identity to enc:ECL_01050)

MetaCyc: 45% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Putative glutathione transporter, permease component" in subsystem Utilization of glutathione as a sulphur source

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>EX28DRAFT_2671 ABC-type dipeptide/oligopeptide/nickel transport systems, permease components (Enterobacter asburiae PDN3)
MAELTTQTVTPVLPRAQNRVLKKFLANKSAVIGAVMVGFFVLVALLAPWIAPFDPVKANF
LAVRKAPSAMYWFGTDELGRDILSRIIWGARTSLMAGCMSVVIAVVIGVPLGLVAGYFQK
MWDGVISRFIEALLACPFLIMAIALGAFLGPSLTNAMIAIGLSAMPIFARLTRGQVIAIR
NEEYIDGARAIGLPDRWIIIKYVLPNVMSPILVQATLAIASAIIAEASLSFLGLGQQPPN
PSWGSMLNTAKGFLEQAPWMSVFPGVAIFLAVQGFNLLGDGLRDALDPRHD