Protein Info for EX28DRAFT_2667 in Enterobacter asburiae PDN3

Annotation: phosphoheptose isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF13580: SIS_2" amino acids 12 to 146 (135 residues), 106.2 bits, see alignment E=1.5e-34 TIGR00441: phosphoheptose isomerase" amino acids 35 to 187 (153 residues), 278.7 bits, see alignment E=6.6e-88 PF01380: SIS" amino acids 107 to 163 (57 residues), 30.4 bits, see alignment E=3.2e-11

Best Hits

Swiss-Prot: 98% identical to GMHA_SALCH: Phosphoheptose isomerase (gmhA) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 100% identity to enc:ECL_01054)

MetaCyc: 97% identical to D-sedoheptulose 7-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase 1 (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.- or 5.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>EX28DRAFT_2667 phosphoheptose isomerase (Enterobacter asburiae PDN3)
MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAM
HFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGYDHIFSRYVEAVGREGDVLLGIST
SGNSGNVIKAIAAAREKGMKVITLTGKDGGKMDGTADVEIRVPHFGYADRIQEIHIKVIH
ILIQLIEKEMVK