Protein Info for EX28DRAFT_2659 in Enterobacter asburiae PDN3

Annotation: NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01941: NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit" amino acids 3 to 407 (405 residues), 760 bits, see alignment E=2.7e-233 PF00111: Fer2" amino acids 39 to 114 (76 residues), 37.7 bits, see alignment E=2.4e-13 PF00970: FAD_binding_6" amino acids 205 to 266 (62 residues), 33.2 bits, see alignment E=8.3e-12 PF00175: NAD_binding_1" amino acids 277 to 386 (110 residues), 68.1 bits, see alignment E=1.5e-22

Best Hits

Swiss-Prot: 92% identical to NQRF_KLEP7: Na(+)-translocating NADH-quinone reductase subunit F (nqrF) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K00351, Na+-transporting NADH:ubiquinone oxidoreductase subunit F [EC: 1.6.5.-] (inferred from 95% identity to enc:ECL_01062)

MetaCyc: 79% identical to Na(+)-translocating NADH-quinone reductase subunit F (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit F (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>EX28DRAFT_2659 NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit (Enterobacter asburiae PDN3)
MEIILGVVMFTLIVLVLSGLILAARAKLVNSGDVVIDINDDPQNQIRTPAGDKLLNTLSG
NGIFVSSACGGGGSCGQCRVTVKEGGGDILPTELAHISKREAKEGCRLACQVAVRQNMKI
ELPEEIFGVKKWECEVISNDNKATFIKELKLRVPEGEHVPFRAGGYIQIECPEHAVAYAD
FDVPHEYRADWDKFNLFRFVSEVKEPTLRAYSMANYPEEKGIIMLNVRIATPPPNVPDAP
PGVMSSYIWSLKPGDKVTISGPFGEFFAKDTDAEMVFIGGGAGMAPMRSHIFDQLKRLGS
QRKISFWYGARSLREMFYEDEFEQLARENPNFTFHVALSDPQPEDNWTGYTGFIHNVLYE
NYLKQHPAPEDCEFYMCGPPMMNAAVIKMLKDLGVEDENILLDDFGG