Protein Info for EX28DRAFT_2652 in Enterobacter asburiae PDN3

Annotation: Outer membrane protein (porin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13609: Porin_4" amino acids 13 to 324 (312 residues), 84.2 bits, see alignment E=1.6e-27 PF00267: Porin_1" amino acids 27 to 350 (324 residues), 495.2 bits, see alignment E=1.2e-152

Best Hits

Swiss-Prot: 97% identical to PHOE_ENTCL: Outer membrane porin PhoE (phoE) from Enterobacter cloacae

KEGG orthology group: K11929, outer membrane pore protein E (inferred from 97% identity to enc:ECL_01073)

MetaCyc: 86% identical to outer membrane porin PhoE (Escherichia coli K-12 substr. MG1655)
RXN0-2481; RXN0-7199; RXN0-7200; RXN0-7201; RXN0-7202; RXN0-7203; RXN0-7204; RXN0-7206; RXN0-7207; RXN0-7208; RXN0-7209; RXN0-7210; RXN0-7211; RXN0-7241; RXN0-7242; RXN0-7243; RXN0-7244; RXN0-7245; RXN0-7246; RXN0-7247; TRANS-RXN0-598; TRANS-RXN0-601; TRANS-RXN0-603; TRANS-RXN0-604; TRANS-RXN0-606; TRANS-RXN0-607; TRANS-RXN0-608; TRANS-RXN0-609; TRANS-RXN0-611; TRANS-RXN0-612; TRANS-RXN0-614; TRANS-RXN0-615

Predicted SEED Role

"Outer membrane pore protein E precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>EX28DRAFT_2652 Outer membrane protein (porin) (Enterobacter asburiae PDN3)
MKKSTLALMVMGVVASASVHAAEVYNKNGNKLDVYGKVKAMHYISDDATKDGDQTYVRFG
FKGETQINDQLTGYGRWESEFAGNKAESDSSQKTRLAFAGLKLKNFGSLDYGRNLGALYD
VEAWTDMFPEFGGDSSAQTDNFMTKRATGLATYRNTDFFGAVDGLDMTLQYQGKNENRDA
KKQNGDGFGTSLTYDFGGSDFAVSGAYTNSDRTNAQNLLARGQGQKAEAWATGLKYDAND
IYLAAMYSETRNMTPISGGFANKAQNFEVVAQYQFDFGLRPSLGYVQSKGKDIEGIGDED
LVKYIDVGATYYFNKNMSTFVDYKINQIDDKNKLGVSSDDIVALGMTYQF