Protein Info for EX28DRAFT_2642 in Enterobacter asburiae PDN3
Annotation: transcriptional regulator, AlpA family
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to Y9K_BPP4: Uncharacterized protein ORF88 from Enterobacteria phage P4
KEGG orthology group: K07733, prophage regulatory protein (inferred from 92% identity to ses:SARI_03879)Predicted SEED Role
"FIG033266: Phage DNA binding protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (88 amino acids)
>EX28DRAFT_2642 transcriptional regulator, AlpA family (Enterobacter asburiae PDN3) MHTALSVPASRPCAHLMPVSAPTQERFLRLPEVIHQCGLSRSTLYDLIAREAFPAQVSLG GKNVAWLQSEVTAWMAERVAHRDRKCDA