Protein Info for EX28DRAFT_2617 in Enterobacter asburiae PDN3

Annotation: Ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details PF07885: Ion_trans_2" amino acids 152 to 218 (67 residues), 40.6 bits, see alignment E=9.3e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>EX28DRAFT_2617 Ion channel (Enterobacter asburiae PDN3)
MKMSDFQCLIEKNSDYKDVCLTILLILQVLTIFIISPVTESEHKNYHWLNNALFSAMALI
SVFIVSKDIKRYLAILSFSFCLVGLAVGSTTTTHKTTGVLVLLSGIFFCLNVSWIVAKQV
FDEGVVTLHRIRGAMVIYLNISLLFALLDCLLVGFIPDAYTGISDDNSIETMLYFSLTTL
TTLGYGDILAIHPFARNLAMLEAVMGQFYMGTMIAILVGLHIAQRTPASKK