Protein Info for EX28DRAFT_2609 in Enterobacter asburiae PDN3

Annotation: Predicted permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 5 to 23 (19 residues), see Phobius details amino acids 29 to 46 (18 residues), see Phobius details amino acids 59 to 85 (27 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 241 to 268 (28 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 320 to 343 (24 residues), see Phobius details PF01594: AI-2E_transport" amino acids 11 to 339 (329 residues), 164.1 bits, see alignment E=2.9e-52

Best Hits

KEGG orthology group: None (inferred from 96% identity to enc:ECL_01097)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>EX28DRAFT_2609 Predicted permease (Enterobacter asburiae PDN3)
MRFNGLTKGFFIFILALVTWAFFDVLSPYFSAILWAAILTVIFNPVKNRLRTALGDRNGL
ASLLTIGIICLIVFIPLMVILSSLAIELNMVYTKLQENNTQFPEVVASIFNHLPDWASGF
LADHNLTNAAQIQKKLSDVALQGGQYLAGSAFLIGKGTFGFAISFGIMLYLLFFLLKDGP
YLVRQILDSLPLSDFAKQHLFAKFVGVSRATVKGTAAVAVVQGILGGIAFAIAGIDGSVL
WGALMAFLSLVPAIGSAIVWVPAAIFLFATHQLWQGLFIVGFFVIIVGLVDNILRPLLVG
KDTKMPDYLILISTLGGMELYGINGFVIGPLIAALFIACWNLFSGRDHEGNAEELDPDFI
EEGKNPPEL