Protein Info for EX28DRAFT_2599 in Enterobacter asburiae PDN3

Annotation: Cyclic nucleotide-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 60 to 79 (20 residues), see Phobius details PF15977: HTH_46" amino acids 138 to 204 (67 residues), 85.9 bits, see alignment E=7.7e-29

Best Hits

Swiss-Prot: 55% identical to IPRA_SALTY: Inhibitor of hydrogen peroxide resistance (iprA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 81% identity to enc:ECL_01130)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>EX28DRAFT_2599 Cyclic nucleotide-binding domain (Enterobacter asburiae PDN3)
MNVNAKPLSELRRLEQHLTAASTPFTCAPQHLITSDEWNEPCTIVLQTGVIEVYRTSDEL
LVGIATAPFIFGLSTVVINHSHEYRVIAKTACTGFYLPTETTRQLIQQYSLWKEAFCWLS
WITYILEKRDKQLVGNNSYHQIRSMLLNMAEWDETLRSKIGVMNHIQQSTRISRSVVAEV
LAALRQGNYINMSRGKLVSINRLPTEY