Protein Info for EX28DRAFT_2592 in Enterobacter asburiae PDN3

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01820: Dala_Dala_lig_N
  • amino acids 5 to 130 (126 residues), 123.3 bits, E=1.6e-39
• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 5 to 350 (346 residues), 393.5 bits, E=3.1e-122
• PF02786: CPSase_L_D2
  • amino acids 140 to 318 (179 residues), 30.9 bits, E=4e-11
• PF07478: Dala_Dala_lig_C
  • amino acids 147 to 348 (202 residues), 271.4 bits, E=8.9e-85
• PF02222: ATP-grasp
  • amino acids 149 to 317 (169 residues), 49.6 bits, E=7.3e-17

Best Hits

Swiss-Prot: 84% identical to DDLA_ECOL6: D-alanine--D-alanine ligase A (ddlA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 95% identity to enc:ECL_01137)

MetaCyc: 84% identical to D-alanine--D-alanine ligase A (Escherichia coli K-12 substr. MG1655)
D-alanine--D-alanine ligase. [EC: 6.3.2.4]

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.4

Use Curated BLAST to search for 6.3.2.4

Protein Sequence (366 amino acids)

>EX28DRAFT_2592 D-alanine--D-alanine ligase (Enterobacter asburiae PDN3)
MAKQRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVNDASQYLLN
AHDPAHIALNPSEVSVATVPGVVKGQLIDAGNAQALAQIDVVFPIVHGTLGEDGSLQGML
RMANLPFVGSDVLGSAACMDKDVAKRLLRDAGLNIAPFVTLTRANRDKHSFAQISGELGL
PLFVKPANQGSSVGVSKVTSEAEFTQAVRLAFEFDHKVVVEQGIKGREIECAVLGNDFPQ
ASTCGEVVLNSDFYSYDTKYIDDKGAQVVVPADIDPAINDKIRAIAIRAYQTLGCCGMAR
VDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLSYPELITRLIELALERHAADSAL
KSSVNG