Protein Info for EX28DRAFT_2578 in Enterobacter asburiae PDN3
Annotation: Transcriptional regulator/sugar kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 89% identical to MAK_ECOLI: Fructokinase (mak) from Escherichia coli (strain K12)
KEGG orthology group: K00847, fructokinase [EC: 2.7.1.4] (inferred from 97% identity to enc:ECL_01151)MetaCyc: 89% identical to fructokinase (Escherichia coli K-12 substr. MG1655)
Mannokinase. [EC: 2.7.1.7]; Fructokinase. [EC: 2.7.1.7, 2.7.1.4]
Predicted SEED Role
"Glucokinase, ROK family (EC 2.7.1.2)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.2)
MetaCyc Pathways
- superpathway of anaerobic sucrose degradation (17/19 steps found)
- glycolysis III (from glucose) (11/11 steps found)
- homolactic fermentation (11/12 steps found)
- glycogen degradation I (8/8 steps found)
- heterolactic fermentation (15/18 steps found)
- glucose and glucose-1-phosphate degradation (5/5 steps found)
- Bifidobacterium shunt (12/15 steps found)
- sucrose degradation III (sucrose invertase) (4/4 steps found)
- sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
- sucrose degradation I (sucrose phosphotransferase) (3/3 steps found)
- trehalose degradation IV (3/3 steps found)
- D-mannose degradation II (2/2 steps found)
- trehalose degradation I (low osmolarity) (2/2 steps found)
- trehalose degradation II (cytosolic) (2/2 steps found)
- 1,3-propanediol biosynthesis (engineered) (7/9 steps found)
- mannitol cycle (4/5 steps found)
- sucrose degradation II (sucrose synthase) (4/5 steps found)
- sucrose biosynthesis II (6/8 steps found)
- mannitol degradation II (3/4 steps found)
- UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
- D-sorbitol degradation I (2/3 steps found)
- GDP-α-D-glucose biosynthesis (2/3 steps found)
- trehalose degradation V (2/3 steps found)
- UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
- glycogen degradation II (4/6 steps found)
- chitin biosynthesis (6/9 steps found)
- 1,5-anhydrofructose degradation (3/5 steps found)
- CMP-2-keto-3-deoxy-D-glycero-D-galacto-nononate biosynthesis (1/4 steps found)
- sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)
- superpathway of CMP-sialic acids biosynthesis (2/15 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Fructose and mannose metabolism
- Galactose metabolism
- Glycolysis / Gluconeogenesis
- Nucleotide sugars metabolism
- Starch and sucrose metabolism
- Streptomycin biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.7.1.2, 2.7.1.4
Use Curated BLAST to search for 2.7.1.2 or 2.7.1.4 or 2.7.1.7
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (330 amino acids)
>EX28DRAFT_2578 Transcriptional regulator/sugar kinase (Enterobacter asburiae PDN3) MITNCRIACIANREACFYSVDNQNNEESLVRIGIDLGGTKTEVIALSEQGEQLFRHRLPT PRDDYRQTIETIASLVEMAEQATGQTGSVGMGIPGSISPYTGVVKNANSTWLNGQPFDKD LSQRLNREVRLANDANCLAVSEAIDGAAAGAQTVFAVIVGTGCGAGVAFGGRAHIGGNGT AGEWGHNPLPWMDEDELKYRAEVPCYCGKQGCIETFISGTGFATDYHRLSGQPLKGNEIM RLVEEQDPVAELALSRYEMRLAKSLAHVVNILDPDVIVLGGGMSNVDRLYATVPNLVKQW VFGGECETPIRKAVHGDSSGVRGAAWLWPE