Protein Info for EX28DRAFT_2574 in Enterobacter asburiae PDN3

Annotation: phosphate regulon sensor kinase PhoR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 10 to 28 (19 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details PF11808: PhoR" amino acids 6 to 91 (86 residues), 96.1 bits, see alignment E=3.9e-31 TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 96 to 421 (326 residues), 451.5 bits, see alignment E=1.6e-139 TIGR00229: PAS domain S-box protein" amino acids 98 to 202 (105 residues), 22.9 bits, see alignment E=7.5e-09 PF00989: PAS" amino acids 99 to 194 (96 residues), 41.3 bits, see alignment E=4.3e-14 PF13188: PAS_8" amino acids 99 to 152 (54 residues), 23.2 bits, see alignment 1.5e-08 PF00512: HisKA" amino acids 203 to 268 (66 residues), 73.3 bits, see alignment E=3.9e-24 PF02518: HATPase_c" amino acids 314 to 424 (111 residues), 98 bits, see alignment E=1.4e-31 PF13581: HATPase_c_2" amino acids 317 to 403 (87 residues), 29.1 bits, see alignment E=2.7e-10

Best Hits

Swiss-Prot: 88% identical to PHOR_ECOLI: Phosphate regulon sensor protein PhoR (phoR) from Escherichia coli (strain K12)

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 96% identity to enc:ECL_01155)

MetaCyc: 88% identical to sensor histidine kinase PhoR (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>EX28DRAFT_2574 phosphate regulon sensor kinase PhoR (Enterobacter asburiae PDN3)
MLERLSWKRLVFELILCCIPAFLLGAFLGHLPWFLLASVTGLLIWHFWNLLRLSWWLWVD
RSMTPPPGSGSWEPLLYGLHQMQMRNKKRRRELGSLIKRFRSGAESLPDAVILTTEEGTI
FWCNGLAQQLLGLRWPDDNGQNILNLLRYPEFTLYLKKRDFTRPHNLKLNNGRHLEIRVM
PYSDKQWLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVLQGYLEMMQEQTLEGAPRE
KALHTMREQTHRMEGLVKQLLTLSKIEAAPTLALNDTIDVPMMLRVVEREAQTLSHKKHH
LTFEVDNTLKVLGSEDELRSAISNLVYNAVNHTPEGTNIVVRWHHAPTGAEFSVEDDGPG
IAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHALNHHESRLDIQSTLGKGTRFSFV
IPERLIAKKIA