Protein Info for EX28DRAFT_2564 in Enterobacter asburiae PDN3

Annotation: preprotein translocase, YajC subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00739: preprotein translocase, YajC subunit
  • amino acids 19 to 102 (84 residues), 116 bits, E=3e-38
• PF02699: YajC
  • amino acids 22 to 99 (78 residues), 91.1 bits, E=1.7e-30

Best Hits

Swiss-Prot: 98% identical to YAJC_ECO57: Sec translocon accessory complex subunit YajC (yajC) from Escherichia coli O157:H7

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 98% identity to eco:b0407)

MetaCyc: 98% identical to Sec translocon accessory complex subunit YajC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Protein Sequence (110 amino acids)

>EX28DRAFT_2564 preprotein translocase, YajC subunit (Enterobacter asburiae PDN3)
MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKNLMNSIAKGD
EVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGTMKAL