Protein Info for EX28DRAFT_2563 in Enterobacter asburiae PDN3

Annotation: protein-export membrane protein, SecD/SecF family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 442 to 460 (19 residues), see Phobius details amino acids 466 to 487 (22 residues), see Phobius details amino acids 493 to 513 (21 residues), see Phobius details amino acids 538 to 560 (23 residues), see Phobius details amino acids 566 to 594 (29 residues), see Phobius details PF13721: SecD-TM1" amino acids 1 to 92 (92 residues), 99 bits, see alignment E=6.1e-32 PF07549: Sec_GG" amino acids 109 to 129 (21 residues), 23.4 bits, see alignment (E = 9.9e-09) TIGR01129: protein-export membrane protein SecD" amino acids 112 to 590 (479 residues), 500.6 bits, see alignment E=3.5e-154 PF21760: SecD_1st" amino acids 216 to 274 (59 residues), 102.3 bits, see alignment 2.3e-33 PF22599: SecDF_P1_head" amino acids 295 to 420 (126 residues), 113.3 bits, see alignment E=1.7e-36 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 334 to 583 (250 residues), 281.1 bits, see alignment E=7.2e-88 PF02355: SecD_SecF_C" amino acids 422 to 590 (169 residues), 55.1 bits, see alignment E=2.1e-18 PF03176: MMPL" amino acids 477 to 589 (113 residues), 32.7 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 93% identical to SECD_ECO57: Protein translocase subunit SecD (secD) from Escherichia coli O157:H7

KEGG orthology group: K03072, preprotein translocase subunit SecD (inferred from 93% identity to eco:b0408)

MetaCyc: 93% identical to Sec translocon accessory complex subunit SecD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (604 amino acids)

>EX28DRAFT_2563 protein-export membrane protein, SecD/SecF family (Enterobacter asburiae PDN3)
MLVVVILVGLLYALPNLYGEDPAVQITGARGVAASEQTLIQVQKTLQEEKITAKSVALEE
GAILARFDTTDTQLRAREALMGVLGDKYVVALNLAPATPRWLAAMKAEPMKLGLDLRGGV
HFLMEVDMDTALGKLQEQNIDSLRSDLRDKGIAYTTVRKEDNYGMSITFRDSAARDQAVD
YLTQRHRDLVITSQGSNQLRAVMTDARLKEAREYAVQQNINILRNRVNQLGVAEPLVQRQ
GADRIVVELPGIQDTARAKEILGATATLEFRLVNSNVDQSAAAAGRIPGDSEVKQTREGQ
PVVLYKRVILTGDHITDSTSSQDEYNQPQVNISLDSAGGNIMSNFTKDNIGKPMATLFVE
YKDSGKKDANGRAVLVKEEEVINIANIQSRLGNSFRITGINNPNEARQLSLLLRAGALIA
PIQIVEERTIGPTLGMQNIQQGLEACLAGLVVSILFMIFFYKKFGLIATSALIANLVLII
GIMSLLPGATLTMPGIAGIVLTLAVAVDANVLINERIKEELSNGRSIQQAIDEGYKGAFS
SIFDANVTTLIKVLILYAVGTGAIKGFAITTGIGVATSMFTAIVGTRAIVNLLYGGKRVK
KLSI