Protein Info for EX28DRAFT_2557 in Enterobacter asburiae PDN3

Annotation: transcriptional regulator NrdR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF22811: Zn_ribbon_NrdR" amino acids 1 to 42 (42 residues), 72.2 bits, see alignment E=2.6e-24 TIGR00244: transcriptional regulator NrdR" amino acids 1 to 147 (147 residues), 251.4 bits, see alignment E=1.4e-79 PF03477: ATP-cone" amino acids 50 to 136 (87 residues), 71.2 bits, see alignment E=8.9e-24

Best Hits

Swiss-Prot: 99% identical to NRDR_ENT38: Transcriptional repressor NrdR (nrdR) from Enterobacter sp. (strain 638)

KEGG orthology group: K07738, transcriptional repressor NrdR (inferred from 99% identity to ent:Ent638_0881)

Predicted SEED Role

"Ribonucleotide reductase transcriptional regulator NrdR" in subsystem Ribonucleotide reduction

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>EX28DRAFT_2557 transcriptional regulator NrdR (Enterobacter asburiae PDN3)
MHCPFCSAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP
FNEEKLRSGMLKALEKRPVSADDVEMALNHIKSYLRGLGEREVPSKMIGNLVMEQLKKLD
KVAYIRFASVYRSFEDIKEFGEEIARLQD