Protein Info for EX28DRAFT_2553 in Enterobacter asburiae PDN3

Annotation: thiamine-phosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 4 to 322 (319 residues), 381 bits, E=1.9e-118
• PF00586: AIRS
  • amino acids 28 to 136 (109 residues), 97.7 bits, E=5.6e-32
• PF02769: AIRS_C
  • amino acids 150 to 297 (148 residues), 40 bits, E=4.6e-14

Best Hits

Swiss-Prot: 85% identical to THIL_ECOL6: Thiamine-monophosphate kinase (thiL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 98% identity to enc:ECL_01175)

MetaCyc: 85% identical to thiamine monophosphate kinase (Escherichia coli K-12 substr. MG1655)
Thiamine-phosphate kinase. [EC: 2.7.4.16]

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• thiamine diphosphate salvage II (5/5 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate salvage V (3/3 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage I (2/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Protein Sequence (323 amino acids)

>EX28DRAFT_2553 thiamine-phosphate kinase (Enterobacter asburiae PDN3)
MACGEFSLIARYFDRVRTSRLDVETGIGDDCALLNIPEKQTLAISTDTLVCGRHFLPDID
PADLAYKALAVNVSDLAAMGADPAWLTLALTLPEVDETWLEAFSDALFEQLNYYDMQLIG
GDTTAGPLSMTLAIHGYVPLGRALKRSGAKPGDWIYVTGTPGDSAAGLAILQNRLTVEDA
DDAAYLVKRHLRPTPRILHGQALRERASSAIDLSDGLISDLGHILKASGVGARVDLDLFP
LSEPLLRHVEPEQALRWALSGGEDYELCFTVPELNRGTLDVALAHLGAKFTCIGQIMPES
EGLKFVKDGAPVTLDWKGYDHFA