Protein Info for EX28DRAFT_2542 in Enterobacter asburiae PDN3

Annotation: cytochrome o ubiquinol oxidase subunit IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 87% identical to CYOD_ECOLI: Cytochrome bo(3) ubiquinol oxidase subunit 4 (cyoD) from Escherichia coli (strain K12)

KEGG orthology group: K02300, cytochrome o ubiquinol oxidase operon protein cyoD (inferred from 100% identity to enc:ECL_01186)

MetaCyc: 87% identical to cytochrome bo3 subunit 4 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)
succinate to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>EX28DRAFT_2542 cytochrome o ubiquinol oxidase subunit IV (Enterobacter asburiae PDN3)
MSHSNDHGASHGSVKTYMTGFILSIILTVIPFWMVMSGSASKPVILGAILVTAVIQILVH
LVCFLHMNTKSDEGWNMTAFIFTVIIIAILVVGSIWIMWNLNYNMMVH