Protein Info for EX28DRAFT_2518 in Enterobacter asburiae PDN3

Annotation: ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 281 to 298 (18 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 32 to 427 (396 residues), 458 bits, see alignment E=1.4e-141 PF00909: Ammonium_transp" amino acids 34 to 427 (394 residues), 430.9 bits, see alignment E=2.1e-133

Best Hits

Swiss-Prot: 90% identical to AMTB_ECOLI: Ammonia channel (amtB) from Escherichia coli (strain K12)

KEGG orthology group: K03320, ammonium transporter, Amt family (inferred from 97% identity to enc:ECL_01212)

MetaCyc: 90% identical to ammonium transporter (Escherichia coli K-12 substr. MG1655)
RXN-9615

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>EX28DRAFT_2518 ammonium transporter (Enterobacter asburiae PDN3)
MKIATLKTGLGSLALLPGLALAATPAVVDKADNAFMMISTALVLFMSIPGIALFYGGLIR
GKNVLSMLTQVAVTFALVCVLWVVYGYSLAFGTGNAFFGNFDWVMLKNIELTALMGSFYQ
YIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWMTLSYVPIAHMVWGGGLLATHG
ALDFAGGTVVHINAAVAGLVGAYLIGKRVGFGKEAFKPHNLPMVFTGTAILYFGWFGFNA
GSASAANEIAALAFVNTVVATAGAILSWVFGEWAVRGKPSLLGACSGAIAGLVGITPACG
YVGVGGALLVGLVSGLAGLWGVTALKRVLRVDDPCDVFGVHGVCGIVGCIMTGIFAAKSL
GGVGYAEGVTMVHQVLVQLESIAITVVWSAVVAFIGYKLADMTVGLRVPEEQEREGLDVN
SHGENAYNA