Protein Info for EX28DRAFT_2499 in Enterobacter asburiae PDN3

Annotation: Acetyltransferase (isoleucine patch superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF12464: Mac" amino acids 7 to 56 (50 residues), 66.1 bits, see alignment E=4e-22 PF14602: Hexapep_2" amino acids 92 to 108 (17 residues), 11.9 bits, see alignment (E = 2.3e-05) amino acids 129 to 164 (36 residues), 37.8 bits, see alignment 1.8e-13 PF00132: Hexapep" amino acids 130 to 164 (35 residues), 42 bits, see alignment 7e-15

Best Hits

Swiss-Prot: 79% identical to MAA_ECOLI: Maltose O-acetyltransferase (maa) from Escherichia coli (strain K12)

KEGG orthology group: K00661, maltose O-acetyltransferase [EC: 2.3.1.79] (inferred from 91% identity to enc:ECL_01230)

MetaCyc: 79% identical to maltose O-acetyltransferase (Escherichia coli K-12 substr. MG1655)
Maltose O-acetyltransferase. [EC: 2.3.1.79]

Predicted SEED Role

"Maltose O-acetyltransferase (EC 2.3.1.79)" in subsystem Maltose and Maltodextrin Utilization (EC 2.3.1.79)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>EX28DRAFT_2499 Acetyltransferase (isoleucine patch superfamily) (Enterobacter asburiae PDN3)
MSLEKQKMIAGEHYRPGDETLRADRLRARHLVYRYNHTAPDEKTERQNILAELLGQGEGA
YIEPSFRCDYGYNIYLGKNFYANFDCVMLDVCPVHIGDNCMLAPGVHIYTATHPLDAEER
NSGVEFGKPVNIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKNVPANVVVGGNPAKII
KTL