Protein Info for EX28DRAFT_2498 in Enterobacter asburiae PDN3

Annotation: Haemolysin expression modulating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 72 PF05321: HHA" amino acids 13 to 69 (57 residues), 133.7 bits, see alignment E=1e-43

Best Hits

Swiss-Prot: 94% identical to HHA_SALTY: Hemolysin expression-modulating protein Hha (hha) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05839, haemolysin expression modulating protein (inferred from 93% identity to ecy:ECSE_0485)

Predicted SEED Role

"Haemolysin expression modulating protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (72 amino acids)

>EX28DRAFT_2498 Haemolysin expression modulating protein (Enterobacter asburiae PDN3)
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLY
DKIPTSVWKFVR