Protein Info for EX28DRAFT_2480 in Enterobacter asburiae PDN3

Annotation: transporter, monovalent cation:proton antiporter-2 (CPA2) family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 112 to 112 (1 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 226 to 243 (18 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 335 to 360 (26 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 15 to 294 (280 residues), 253.4 bits, see alignment E=1.5e-79 PF00999: Na_H_Exchanger" amino acids 16 to 384 (369 residues), 189.8 bits, see alignment E=7.3e-60 PF02254: TrkA_N" amino acids 421 to 534 (114 residues), 92.3 bits, see alignment E=2.6e-30

Best Hits

Swiss-Prot: 93% identical to YBAL_ECOLI: Putative cation/proton antiporter YbaL (ybaL) from Escherichia coli (strain K12)

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 98% identity to enc:ECL_01248)

Predicted SEED Role

"POTASSIUM/PROTON ANTIPORTER ROSB" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>EX28DRAFT_2480 transporter, monovalent cation:proton antiporter-2 (CPA2) family (Enterobacter asburiae PDN3)
MHHATPLITTIVGGLVLAFILGMIANKLRISPLVGYLLAGVLAGPFTPGFVADTKLAPEL
AELGVILLMFGVGLHFSLKDLMAVKSIAIPGAIAQIGVATLLGMALSAVLGWSLMTGIVF
GLCLSTASTVVLLRALEERQLIDSQRGQIAIGWLIVEDLVMVLTLVLLPAVAGMMEKDNV
GFASLALDMSITIGKVVAFIAIMMLVGRRLVPWIMSRSAATGSRELFTLSVLALALGIAF
GAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAFAVLFFVSVGMLFDPMVLIH
QPLAVLGTLAIIIFGKSLAAFFLVRMFGHSPRTALTIAASLAQIGEFAFILAGLGMALNL
LPQAGQNLVLAGAILSIMLNPVLFALLEKYLDKTETLEEQTLEEAIEEEKQIPVDICNHA
LLVGFGRVGSLLGEKLMAQGIPLVVIETSRTRVDELRERGIRAVLGNAANEEIMNLAHLD
CARWLLLTIPNGYEAGEIVASAREKCPTIEIIARAHYDDEVEYITERGANKVVMGEREIA
NTMLTLLENPPLEEAVTS