Protein Info for EX28DRAFT_2479 in Enterobacter asburiae PDN3

Annotation: Nitrate/nitrite transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 53 to 79 (27 residues), see Phobius details amino acids 95 to 126 (32 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 376 to 395 (20 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 260 (234 residues), 101.2 bits, see alignment E=2.9e-33 amino acids 229 to 401 (173 residues), 51.4 bits, see alignment E=4.2e-18

Best Hits

Swiss-Prot: 92% identical to FSR_ECOLI: Fosmidomycin resistance protein (fsr) from Escherichia coli (strain K12)

KEGG orthology group: K08223, MFS transporter, FSR family, fosmidomycin resistance protein (inferred from 97% identity to enc:ECL_01249)

MetaCyc: 92% identical to fosmidomycin efflux pump (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-41

Predicted SEED Role

"Fosmidomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>EX28DRAFT_2479 Nitrate/nitrite transporter (Enterobacter asburiae PDN3)
MAISESTQPVPGTPASRTSFKVLGAISLSHLLNDMIQSLILAIYPLLQSEFSLTFVQIGM
ITLTFQLASSLLQPVVGYWTDKYPMPWSLPIGMCFTLSGLVLLAMAGSFEAVLIAAALVG
TGSSVFHPESSRVARMASGGRHGLAQSLFQVGGNFGSSLGPLLAAVIIAPYGKGNVAWFV
LAALLAIIVLAQISRWYAAQHRVNKGKPKAKVINPLPRNKVILAVSVLLVLIFSKYFYMA
SISSYYTFYLMQKFGLSVQNAQIHLFAFLFAVAAGTVIGGPVGDKIGRKYVIWGSILGVA
PFTLILPYASLEWTGILTVIIGFILASAFSAILVYAQELLPGRIGMVSGLFFGFAFGMGG
LGAAVLGMVADHTSIFLVYKICAFLPLLGMLTIFLPDNRHKA