Protein Info for EX28DRAFT_2467 in Enterobacter asburiae PDN3

Annotation: Thioredoxin domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF00085: Thioredoxin" amino acids 6 to 107 (102 residues), 72.5 bits, see alignment E=6.4e-24 PF13728: TraF" amino acids 7 to 87 (81 residues), 28.1 bits, see alignment E=4.5e-10 PF14559: TPR_19" amino acids 124 to 190 (67 residues), 71 bits, see alignment E=2.1e-23 PF14561: TPR_20" amino acids 195 to 284 (90 residues), 98.8 bits, see alignment E=4.5e-32

Best Hits

Swiss-Prot: 89% identical to CNOX_ECOLI: Chaperedoxin (cnoX) from Escherichia coli (strain K12)

KEGG orthology group: K05838, putative thioredoxin (inferred from 97% identity to enc:ECL_01259)

Predicted SEED Role

"FIG000875: Thioredoxin domain-containing protein EC-YbbN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>EX28DRAFT_2467 Thioredoxin domain-containing protein (Enterobacter asburiae PDN3)
MSVQNIVNITEANLQQTLEQSMTKPVLFYFWSERSQHCLQLTPVLESLAAQYNGQFILAK
LDCDAEPMVASQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLPREEELKAQE
GMALMQEGKYDEALPLLKEAWQLSNQNSQIGLLLAETQIALHRSEDAEAVLKTIPMQDQD
TRYQGLVAQIELLKQAADTPEIQQLQQQVADNPADAALASQLALQLHQVGRNEEALELLF
SHLQKDLAAADGQARKMFQEILAALGTGDALASKYRRQLYALLY