Protein Info for EX28DRAFT_2456 in Enterobacter asburiae PDN3

Annotation: UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12850: Metallophos_2
  • amino acids 1 to 120 (120 residues), 27.9 bits, E=2.2e-10
• PF00149: Metallophos
  • amino acids 2 to 199 (198 residues), 47.9 bits, E=2.4e-16
• TIGR01854: UDP-2,3-diacylglucosamine diphosphatase
  • amino acids 3 to 232 (230 residues), 371.3 bits, E=7.8e-116

Best Hits

Swiss-Prot: 90% identical to LPXH_ENT38: UDP-2,3-diacylglucosamine hydrolase (lpxH) from Enterobacter sp. (strain 638)

KEGG orthology group: K03269, UDP-2,3-diacylglucosamine hydrolase [EC: 3.6.1.-] (inferred from 92% identity to enc:ECL_01270)

MetaCyc: 82% identical to UDP-2,3-diacylglucosamine diphosphatase (Escherichia coli K-12 substr. MG1655)
LIPIDXSYNTHESIS-RXN [EC: 3.6.1.54]

Predicted SEED Role

"UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)" (EC 3.6.1.54)

MetaCyc Pathways

• superpathway of (Kdo)₂-lipid A biosynthesis (17/17 steps found)
• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (17/25 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.54

Protein Sequence (240 amino acids)

>EX28DRAFT_2456 UDP-2,3-diacylglucosamine hydrolase (EC 3.6.1.54) (Enterobacter asburiae PDN3)
MATLFIADLHLQTEEPAITAGFLRFLRGEAKSADALYILGDLFEAWIGDDDPNPLHREMA
AAIHALVDSGVPCYFIHGNRDFLIGKRYARESGMTLLPEEQVLDLYGRRILIMHGDTLCT
DDTGYLAFRAKVHTPWIQKVFLALPLFIRNRIAARMRAGSKAANSSKSMTIMDVNPQAVA
SVMEKHGVQWLIHGHTHRPDVHSLIASGEPAHRVVLGAWHTEGSMVKVSPEGVELIAFPF