Protein Info for EX28DRAFT_2453 in Enterobacter asburiae PDN3

Annotation: Predicted membrane-bound metal-dependent hydrolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 signal peptide" amino acids 12 to 18 (7 residues), see Phobius details transmembrane" amino acids 28 to 45 (18 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details PF04307: YdjM" amino acids 1 to 170 (170 residues), 113.5 bits, see alignment E=4.1e-37

Best Hits

Swiss-Prot: 91% identical to YBCI_ECOLI: Inner membrane protein YbcI (ybcI) from Escherichia coli (strain K12)

KEGG orthology group: K07038, inner membrane protein (inferred from 97% identity to enc:ECL_01273)

Predicted SEED Role

"Putative membrane-bound metal-dependent hydrolases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>EX28DRAFT_2453 Predicted membrane-bound metal-dependent hydrolases (Enterobacter asburiae PDN3)
MPTVITHAAVPLCLGLGLGTKVIPPRLLFAGIVLAMLPDADVLAFKFGVAYGNVFGHRGF
THSLLFAFVVPILCVLIGRRWFRASLTRCWLFLTVSLLSHSLLDSITTGGKGVGWLWPWS
DERFFAPWQVIKVAPFALSRYTTPYGHQVIVSELLWVWLPGVVLMGLLWWRRR