Protein Info for EX28DRAFT_2447 in Enterobacter asburiae PDN3

Annotation: P pilus assembly protein, pilin FimA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00419: Fimbrial" amino acids 31 to 180 (150 residues), 64.9 bits, see alignment E=5.3e-22

Best Hits

Swiss-Prot: 60% identical to FIMI_SALTY: Fimbrin-like protein FimI (fimI) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07351, fimbrial protein (inferred from 96% identity to enc:ECL_01279)

Predicted SEED Role

"Fimbriae-like adhesin FimI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>EX28DRAFT_2447 P pilus assembly protein, pilin FimA (Enterobacter asburiae PDN3)
MTRTGTLLLLTLAMACPASAHTVVIEGGKVHLRGELVNGGCAVAPDSQNMRIDMGQYRTN
SFSGVGSFSTVNVPFTVRLLDCSVDVSRTVGIQFQGVTPAEDPQVFLATSRPGETPVSSG
VGLALFDEQQRQIIPNATAVSWLPIDTRELAFHFSARYRAISEHLEPGKIQSDVWFTLIY
P