Protein Info for EX28DRAFT_2438 in Enterobacter asburiae PDN3

Annotation: CAAX protease self-immunity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 201 to 218 (18 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details PF02517: Rce1-like" amino acids 169 to 259 (91 residues), 72.2 bits, see alignment E=1.8e-24

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 95% identity to enc:ECL_03177)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>EX28DRAFT_2438 CAAX protease self-immunity (Enterobacter asburiae PDN3)
MWYLLATSLAALSLNKSLAYLMLGLTAFLGWKQGILDAPALLVIASIVVGWSAVEWLRNK
NNKYTYLVEGLCVVIAVALVLHVIPGFHNPKVLDAVVVGPQSIPFSMYFNMDKAVVPFFL
ITCMPTLFVAKPLYQAGKVGWGILVLAIPALLLLAVALGGLRIEPHAPEWFAQFALANIF
FVSLAEEALFRGYLQQRLSRVIHPVVALLIASVIFGLMHYSGGLLLIIFASLSGIIYGLA
WMWSGKLWVATLFHFGLNCVHLLLFTYPMYAPHAAM