Protein Info for EX28DRAFT_2432 in Enterobacter asburiae PDN3

Annotation: Gamma-aminobutyrate permease and related permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 58 to 75 (18 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 295 to 313 (19 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details amino acids 412 to 432 (21 residues), see Phobius details amino acids 438 to 458 (21 residues), see Phobius details PF00324: AA_permease" amino acids 31 to 461 (431 residues), 427.9 bits, see alignment E=4.8e-132 PF13520: AA_permease_2" amino acids 35 to 434 (400 residues), 127.5 bits, see alignment E=6.8e-41

Best Hits

Swiss-Prot: 90% identical to PHEP_ECOLI: Phenylalanine-specific permease (pheP) from Escherichia coli (strain K12)

KEGG orthology group: K11732, phenylalanine-specific permease (inferred from 97% identity to enc:ECL_03169)

MetaCyc: 90% identical to phenylalanine:H+ symporter PheP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56

Predicted SEED Role

"Phenylalanine-specific permease" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>EX28DRAFT_2432 Gamma-aminobutyrate permease and related permeases (Enterobacter asburiae PDN3)
MKDASSASGHGSAEASSDQNPTLQRGLQNRHIQLIALGGAIGTGLFLGIGPAIQMAGPAV
LLGYGIAGIIAFLIMRQLGEMVVEEPVSGSFAHFAYKYWGPFAGFLSGWNYWVMFVLVGM
AELTAAGIYMQYWLPDVPTWIWAAAFFIIINAVNLVNVRLYGETEFWFALIKVLAIIGMI
GFGLWLLFSGHGGERATIDNLWQHGGFLATGWKGLILSLAVIMFSFGGLELIGITAAEAR
DPHKSIPKAVNQVVYRILLFYIGSLVVLLALYPWVEVKSDSSPFVMIFHDMNSNLVASAL
NFVILVASLSVYNSGVYSNSRMLFGLSVQGNAPKFLTRVSRRGVPVNSLFLSGAITSLVV
LINYLLPKEAFGLLMALVVATLLLNWIMICLAHLRFRAAMRRKGRETQFKALLYPAGNYI
CIAFLGLILVLMCTMDEMRLSAMLLPVWVVFLFIAFKLSRKK