Protein Info for EX28DRAFT_2431 in Enterobacter asburiae PDN3

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 166 to 192 (27 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 184 to 252 (69 residues), 63.2 bits, see alignment E=1.9e-21 PF21082: MS_channel_3rd" amino acids 329 to 396 (68 residues), 44.2 bits, see alignment E=2.2e-15

Best Hits

Swiss-Prot: 84% identical to YBDG_ECOLI: Miniconductance mechanosensitive channel YbdG (ybdG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to enc:ECL_03162)

Predicted SEED Role

"Uncharacterized protein ybdG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>EX28DRAFT_2431 Small-conductance mechanosensitive channel (Enterobacter asburiae PDN3)
MQELIAQVEELGIEINHTTSLVIIFGIIFLTAIIVHFILHKVVLRAFEKRAQASSHLWLQ
IITQNKLFHRLAFTLQGIIVNVQAVLWLQKGSEAAEILTTCAKLWVMVYALLSFFSLLDV
IFNLSQKMATASQLPLKGIFQGIKLVSAILVGILIISLLIGQSPAILISGLGAMAAVLML
VFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGANGTVTDIGLTTVKVRNFDNTITTIPT
WALVSDAFINWSGMSASGGRRIKRSLNIDTTSIHFLDEQEQQKLIQAKLLKPYLAARHEE
INLWNQKNGEGESVLNLRKMTNIGTFRAYLNEYLRNHPRIRKDMTLMVRQLAPDANGLPI
EIYAFTNTVVWAEYEEIQADIFDHIFAVVDEFGLRIHQSPTGNDIRSLAGVIAR