Protein Info for EX28DRAFT_2430 in Enterobacter asburiae PDN3

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 50 to 66 (17 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 272 to 297 (26 residues), see Phobius details amino acids 309 to 326 (18 residues), see Phobius details amino acids 338 to 360 (23 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 404 to 429 (26 residues), see Phobius details amino acids 441 to 460 (20 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 419 (403 residues), 131.1 bits, see alignment E=2.4e-42

Best Hits

KEGG orthology group: None (inferred from 92% identity to enc:ECL_03161)

Predicted SEED Role

"Probable MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>EX28DRAFT_2430 Arabinose efflux permease (Enterobacter asburiae PDN3)
MNTSVVSPGRAGLILLLTGQMLPMIDTSITNVALDAITHSLNATATELELIVALYGVAFA
VCLALGSKLGDNFGRRRLFMWGVASFGLASLLCGMAGNIEQLLAARIVQGAGAALIVPQI
LATLHVTLKGTAHAKAISLFGGIGGIAFIVGQMGGGWLVSADIAGLGWRNAFFINVPICL
VVLALSRHFVPETRRETPSRIDWTGTVLLAIILCCLLFPMALGPQWHWSWPLKVMLLAII
PLAWLTALNARKKERDNAHPLIPPRLLQLRSVRFGILIAMLFFSVWSGFMFCMALTMQTG
LGMAPWQSGNSFIALGVTYFISAWFAPRLIARYSTSTILLTGLAIQIVGLLALIATFRVW
GMENTALTLAPATGLVGYGQALIVNSFYRIGMRDIQPDDAGAASAILSTLQQAALGLGPA
IFGAILLHALQNHHGDYTQAVNVFLMVETAMMVVLALATLRIRHRLCLPMVKVCQATK