Protein Info for EX28DRAFT_2420 in Enterobacter asburiae PDN3

Annotation: ATPase, P-type (transporting), HAD superfamily, subfamily IC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 902 transmembrane" amino acids 65 to 87 (23 residues), see Phobius details amino acids 93 to 109 (17 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 287 to 313 (27 residues), see Phobius details amino acids 699 to 723 (25 residues), see Phobius details amino acids 729 to 750 (22 residues), see Phobius details amino acids 771 to 792 (22 residues), see Phobius details amino acids 801 to 819 (19 residues), see Phobius details amino acids 840 to 859 (20 residues), see Phobius details amino acids 871 to 890 (20 residues), see Phobius details PF00690: Cation_ATPase_N" amino acids 18 to 83 (66 residues), 73.1 bits, see alignment 3.5e-24 TIGR01494: HAD ATPase, P-type, family IC" amino acids 95 to 207 (113 residues), 65.8 bits, see alignment E=1.3e-22 amino acids 230 to 358 (129 residues), 77.1 bits, see alignment E=4.9e-26 amino acids 607 to 731 (125 residues), 121.3 bits, see alignment E=1.9e-39 PF00122: E1-E2_ATPase" amino acids 124 to 236 (113 residues), 105 bits, see alignment E=4.8e-34 PF00702: Hydrolase" amino acids 334 to 652 (319 residues), 63.8 bits, see alignment E=8.8e-21 PF13246: Cation_ATPase" amino acids 391 to 548 (158 residues), 91 bits, see alignment E=2.6e-29 PF00689: Cation_ATPase_C" amino acids 723 to 894 (172 residues), 147.8 bits, see alignment E=8.9e-47

Best Hits

KEGG orthology group: None (inferred from 96% identity to enc:ECL_03151)

Predicted SEED Role

"Putative cation-transporting P-type ATPase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (902 amino acids)

>EX28DRAFT_2420 ATPase, P-type (transporting), HAD superfamily, subfamily IC (Enterobacter asburiae PDN3)
MTEKKLSPNVPPSGGLAYQQTVEQVLTHTQSQASGLDSAEAQARLQKSGPNALPEKKGKP
AWLRFLAHFNDVLIYVLLAAAVLTAIMGHWVDTLVILGVAVINALIGHIQESNAEKSLKS
IRNMLSSEARVIRNGTHETIPTTEIVPGDIIVLRAGDRIPADMRLIEAHNLRVEEAILTG
ESTVVDKHINPLNGELPLGDRTNMVFSGTTVSAGGGVGVVTATGKDTELGHINQMMAGIE
KHRTPLLVQMDKLGKAIFAIILAMMAALFVFSLVFREIPMGELLLSLISLAVASVPEGLP
AIISIILSLGVQAMARKRAIIRKLPTVETLGAMTVVCSDKTGTLTMNEMTVKAIITADAC
YRVDGNSYEPVGNIYLEGSDEPVHIQPGTVLEQYLRTIDLCNDSQLIQDERGLWGITGGP
TEGALKVLAAKASLEPVMTTLVNKIPFDSQYKYMSTHYQIGGEEQILITGAPDVIFALCA
EQQTRNGAEVFNRAYWESEMERYARQGLRMVAAAFKPANGEQALTHDDLSNGLIFLGIAG
MMDPPRPEAIDAINACQQAGIRVKMITGDHPQTAMSIGQMLGITNSEQAVTGYELEKMDD
AALAEAAVKYDIFARTSPEHKLRLVKALQDKGEIVGMTGDGVNDAPALRQADVGIAMGIK
GTEVTKEAADMVLTDDNFATIASAVKEGRRVYDNLKKTILFIMPTNLAQGLLIVIALLAG
NIIPLTPVLILWMNMATSATLSFGLAFEAAERNIMRRPPRQTGQHVMDAYAVWRVAFVGT
MIAIAAFALEAWLAPRGHSAEFIRTVLLQMLVCAQWVYMINCRNTEGFSLNRGLLANKGI
WLVTGVLFLLQAAIIYLPLMQMLFGTEALPLRYWFVTLAVAGVMFFVVEIEKRLTRRFRK
AA