Protein Info for EX28DRAFT_2419 in Enterobacter asburiae PDN3

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 24 to 352 (329 residues), 271.8 bits, see alignment E=3.3e-85 PF25917: BSH_RND" amino acids 49 to 182 (134 residues), 56.5 bits, see alignment E=7.4e-19 PF25885: HH_EMRA" amino acids 90 to 161 (72 residues), 36.2 bits, see alignment E=2.5e-12 PF25876: HH_MFP_RND" amino acids 90 to 158 (69 residues), 36.9 bits, see alignment E=1.2e-12 PF25944: Beta-barrel_RND" amino acids 214 to 275 (62 residues), 38.2 bits, see alignment E=5.6e-13 PF25954: Beta-barrel_RND_2" amino acids 228 to 278 (51 residues), 23.7 bits, see alignment 1.6e-08 PF25967: RND-MFP_C" amino acids 283 to 343 (61 residues), 52.6 bits, see alignment E=1.2e-17

Best Hits

KEGG orthology group: None (inferred from 88% identity to enc:ECL_03150)

Predicted SEED Role

"Probable RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>EX28DRAFT_2419 RND family efflux transporter, MFP subunit (Enterobacter asburiae PDN3)
MKLPLLFALLACTLQPVFAAAIPVRVAAVEQTAHAAERQIPGRIEAIHTVELRARTEGAI
AKIHFRDGQYVKKGDLLFELDDAEPRAALRLAQAEVRSAEATLRQAQQQLSRFESLGSSN
AISRHDVDNARMQRDVASAALEQAKARLETRNVTLNYTRITSPIDGRVGHSRFHVGSLVN
PASGVLVEVVQLDPIRIAFALEEGAFATKAGQHADISAMKQAWQAFIDSNGQRVIGELTS
VDNRIDPRTASVMLRAEFANPRHQLLPGGSVNVTLRPASEQPVLTLPAAAVQQNGDGFFA
WVVNADGKAEMRPLKVAGQIGQQFRITSGVKPGERAITDGAQRVQPGAAVQILN