Protein Info for EX28DRAFT_2417 in Enterobacter asburiae PDN3

Annotation: carboxylate-amine ligase, YbdK family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR02050: carboxylate-amine ligase, YbdK family" amino acids 13 to 295 (283 residues), 361.6 bits, see alignment E=1.5e-112 PF04107: GCS2" amino acids 13 to 363 (351 residues), 329.5 bits, see alignment E=1.6e-102

Best Hits

Swiss-Prot: 88% identical to GCS2_ENT38: Putative glutamate--cysteine ligase 2 (Ent638_1085) from Enterobacter sp. (strain 638)

KEGG orthology group: K06048, carboxylate-amine ligase [EC: 6.3.-.-] (inferred from 97% identity to enc:ECL_03148)

MetaCyc: 76% identical to putative glutamate--cysteine ligase 2 (Escherichia coli K-12 substr. MG1655)
Glutamate--cysteine ligase. [EC: 6.3.2.2]

Predicted SEED Role

"FIG00732033: hypothetical protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.2

Use Curated BLAST to search for 6.3.-.- or 6.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>EX28DRAFT_2417 carboxylate-amine ligase, YbdK family (Enterobacter asburiae PDN3)
MPLPDFKSSEPFTLGIELELQVVNPPGYDLSQDSSALIAAVKDDIKGGEVKHDITESMLE
IATGVCQNIDQAAAQFSVMQQSILRAAAEQHIQICGGGTHPFQKWQRQEVCDDERYNVTL
ERFGYLILQATVFGQHVHVGCRTGDDAIYLLHGLSRFVPHFIALAAASPYMQGTDTKFSS
SRLNIFSGFPDNGQMPWVNSWQEFEGLFRRLSSTSMIDSIKDLHWDIRPSPHFGTVEVRV
MDTPLTLGHAINIAGLIQATSHWLLTARPYKHQEKDFLLYRFNRFQACRYGLEGILTDVH
TGEHKTVAEDIAWLLEQVAPSAEKLGATSAINEIALLLKQGKSEAQRMREFIADGGSLIS
LVQKHCELWATSP