Protein Info for EX28DRAFT_2395 in Enterobacter asburiae PDN3

Annotation: ABC-type dipeptide transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00496: SBP_bac_5" amino acids 70 to 435 (366 residues), 237.2 bits, see alignment E=1.6e-74

Best Hits

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 95% identity to ent:Ent638_1105)

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2); Putative hemin-binding lipoprotein" (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (522 amino acids)

>EX28DRAFT_2395 ABC-type dipeptide transport system, periplasmic component (Enterobacter asburiae PDN3)
MTKKLLPLLVLAALSGAVHAATPPNTLVVAQGLDDIVSLDPAEANELSSIQTVPSLYQRL
VQPDRDNPEKITPILAESWEADAAAKTLTIKLKPDARFASGNPLRPEDVIFSYTRAVTLN
KSPAFILNVLGWDASNIASQLKKVDDHTLQLHWTADVSPSVALNILSTPIASIVDEKQVA
ANVKDNDFGNAWLKMHSAGSGAFKMRVYQPHQAIVLEANDSAPGGAPKLKSIIIKNVPDP
ASRRLLIQQGDADVARDLGADQISALDGKPGVKVLSIPSAEQNYLVFNTGNSANPLLNNP
AFWEASRWLVDYEGITKNLLKGQYFVHQSFLPVGLPGALEDNPFKFDPAKAKAILAKAGI
KDAHFTLDVENKPPFITIAQSMQASFAQGGVKVDLLPAAGSQVYARVRAKQHQAAIRLWI
PDYFDAHSNASAFAWNDGKSSTVAGLNGWKIPELNKATLAAVAEPDPAKRLDLYKKMQEQ
LQQSSPYVFVDQGKTQIVVRDNVKGYQQGLNADMVWYDRVTK