Protein Info for EX28DRAFT_2384 in Enterobacter asburiae PDN3

Annotation: Phosphopantetheinyl transferase component of siderophore synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF17837: 4PPT_N" amino acids 37 to 96 (60 residues), 43.7 bits, see alignment E=2.4e-15 PF01648: ACPS" amino acids 104 to 188 (85 residues), 42.5 bits, see alignment E=5.8e-15

Best Hits

KEGG orthology group: K02362, enterobactin synthetase component D [EC: 2.7.8.-] (inferred from 76% identity to enc:ECL_03118)

Predicted SEED Role

"4'-phosphopantetheinyl transferase (EC 2.7.8.-) [enterobactin] siderophore" in subsystem Siderophore Enterobactin (EC 2.7.8.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>EX28DRAFT_2384 Phosphopantetheinyl transferase component of siderophore synthetase (Enterobacter asburiae PDN3)
MHTIHSTFSLAGHTVHHVTFDPTTFTDADLLWLPHHAELSNAGRKRKAEHLAGRIATAHA
LPDRIVPGIGPSGEPLWAEGVSGSITHSGTQAMAVVVRHQDALVGIDCEAILPDHEAREI
QDGIVDAQEAMCLTHSGYPFALALTLAFSAKESLFKALFPQVKIFMGFEWARVTEVTEKT
ITLALSRPAGQYPEGKRFTLVWQHDNGNVWTLLKA