Protein Info for EX28DRAFT_2377 in Enterobacter asburiae PDN3

Annotation: ABC-type Fe3+-siderophore transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 61 to 81 (21 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 239 to 265 (27 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details PF01032: FecCD" amino acids 19 to 328 (310 residues), 306.2 bits, see alignment E=1.1e-95

Best Hits

Swiss-Prot: 86% identical to FEPD_ECOLI: Ferric enterobactin transport system permease protein FepD (fepD) from Escherichia coli (strain K12)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 93% identity to enc:ECL_03111)

MetaCyc: 86% identical to ferric enterobactin ABC transporter membrane subunit FebD (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Ferric enterobactin transport system permease protein FepD (TC 3.A.1.14.2)" in subsystem Siderophore Enterobactin (TC 3.A.1.14.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>EX28DRAFT_2377 ABC-type Fe3+-siderophore transport system, permease component (Enterobacter asburiae PDN3)
MSFSSSAVRAVAVPVLLLLLILAAALSLLVGAKPLHASVIVDALSGTCQSADCVIVLDAR
LPRTLAGLLAGGALGLAGALMQTLTRNPLADPGILGVNSGASFAIVLGAALFGLTSPSEQ
LAMAFCGALAASLVVAFTGSQGGGQLSPVRLTLAGVALAAVLEGLSNGIALLNPDVYDQL
RFWQAGSLDIRTLETLKVVAFPVIFAASVALFLSRSLNSLSLGSDTATALGNRVARTQLI
GLLAITVLCGSATAVVGPIAFIGLMMPHMARWLVGADHRWSLPVTLLATPALLLFADVLG
RLLVPGELRVSVVSAFIGAPVLIFLVRRKRGGGA