Protein Info for EX28DRAFT_2365 in Enterobacter asburiae PDN3

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00106: adh_short" amino acids 8 to 200 (193 residues), 185.7 bits, see alignment E=1.4e-58 PF01370: Epimerase" amino acids 10 to 185 (176 residues), 23 bits, see alignment E=9.7e-09 PF08659: KR" amino acids 11 to 183 (173 residues), 52.8 bits, see alignment E=9.8e-18 PF13561: adh_short_C2" amino acids 14 to 246 (233 residues), 201.4 bits, see alignment E=3.5e-63

Best Hits

Swiss-Prot: 44% identical to FABG_STAAR: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Staphylococcus aureus (strain MRSA252)

KEGG orthology group: None (inferred from 96% identity to enc:ECL_03098)

Predicted SEED Role

"2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (EC 1.3.1.28) [enterobactin] siderophore" in subsystem Siderophore Enterobactin (EC 1.3.1.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.28

Use Curated BLAST to search for 1.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>EX28DRAFT_2365 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Enterobacter asburiae PDN3)
MQIDLTGKKALVTGASRGLGRAIALSLARAGADVIITYEKSADKAQAVADEIKALGRHSE
AVQADSASAQAIQDAVTHAARSLGGLDILVNNAGIARGGPLESMTLADIDALINVNIRGV
VIAIQEALVHMSDGGRIINIGSCLANRVAMPGIAVYSMTKSALNSLTRGLARDLGPRGIT
VNLVHPGPTNSDMNPEDGEQAEAQRQMIAVGHYGQPEDIAAAVTFLASPAAGQISGTGLD
VDGGLNA