Protein Info for EX28DRAFT_2347 in Enterobacter asburiae PDN3

Annotation: Threonine dehydrogenase and related Zn-dependent dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 PF08240: ADH_N" amino acids 24 to 153 (130 residues), 88.3 bits, see alignment E=3.7e-29 PF00107: ADH_zinc_N" amino acids 197 to 285 (89 residues), 42.9 bits, see alignment E=4.7e-15

Best Hits

Swiss-Prot: 88% identical to YBDR_ECOLI: Uncharacterized zinc-type alcohol dehydrogenase-like protein YbdR (ybdR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to enc:ECL_03078)

Predicted SEED Role

"Uncharacterized zinc-type alcohol dehydrogenase-like protein ybdR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>EX28DRAFT_2347 Threonine dehydrogenase and related Zn-dependent dehydrogenases (Enterobacter asburiae PDN3)
MKALTYHGPHHVRVENVPDPIIEQPDDIILRVTATAICGSDLHLYRGKIPKVQHGDIFGH
EFMGEIVECGAEVKNLQKGDRVVIPFVIACGDCFFCRMQQYAACENTNAGQGAALNKKQI
PAPAALFGYSHLYGGVPGGQAEYVRVPKGNVGPFKVPQLLSDDKALFLSDILPTAWQAAK
NAQIEKGSSVAVFGAGPVGLLTIACARLLGAEQIFVIDHHPYRLRFAEARYGAIPINFDD
DNDAAEKIIEQTAGQRGVDAVIDAVGFEAKGSTTETILSNLKIEGSSGKALRQCIAAVRR
GGVVSVPGVYAGFIHGFLFGDAFDKGLTFKMGQTHVHAWLGELLPLIEKGLLTPEEIVTH
YLPLADAEHAYKVFEKREEECRKVILVPGAETPEAAEQKVKGLVNAFPGGVA