Protein Info for EX28DRAFT_2337 in Enterobacter asburiae PDN3
Annotation: Predicted amidohydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 74% identical to YBEM_ECO57: Deaminated glutathione amidase (ybeM) from Escherichia coli O157:H7
KEGG orthology group: None (inferred from 85% identity to enc:ECL_03069)Predicted SEED Role
"Aliphatic amidase AmiE (EC 3.5.1.4)" (EC 3.5.1.4)
MetaCyc Pathways
- acrylonitrile degradation I (1/2 steps found)
- indole-3-acetate biosynthesis III (bacteria) (1/2 steps found)
- indole-3-acetate biosynthesis IV (bacteria) (1/2 steps found)
- L-arginine degradation X (arginine monooxygenase pathway) (1/3 steps found)
- superpathway of acrylonitrile degradation (1/3 steps found)
- indole-3-acetate biosynthesis II (4/12 steps found)
KEGG Metabolic Maps
- Arginine and proline metabolism
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Cyanoamino acid metabolism
- Phenylalanine metabolism
- Styrene degradation
- Tryptophan metabolism
- Urea cycle and metabolism of amino groups
Isozymes
Compare fitness of predicted isozymes for: 3.5.1.4
Use Curated BLAST to search for 3.5.1.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (262 amino acids)
>EX28DRAFT_2337 Predicted amidohydrolase (Enterobacter asburiae PDN3) MYVAVGQFVVTPDWRENALTCVELMMQARQKGASLLVLPEALLARDDNDPDLSVKSAQPL DGEFLQLLLAQSAGNTMTTILTIHIPSTPGRAVNTLVAIRNGTIVARYAKLHLYDAFSIQ ESRRVDSGNSIPPLLEIDGFKIGLMTCYDLRFPELALHLALQGADVLVLPAAWVRGPLKE HHWATLLAARALDTTCYVVAAGECGTKNIGQSRVVDPMGVTIAAAAEAPHLLVAEINLER IALARQQLPVLRNRRFAPPQLL