Protein Info for EX28DRAFT_2336 in Enterobacter asburiae PDN3

Annotation: twin arginine-targeting protein translocase, TatA/E family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01411: twin arginine-targeting protein translocase, TatA/E family
  • amino acids 4 to 47 (44 residues), 70.1 bits, E=4.4e-24
• PF02416: TatA_B_E
  • amino acids 4 to 56 (53 residues), 47.8 bits, E=3.5e-17

Best Hits

Swiss-Prot: 97% identical to TATE_ENTCC: Probable Sec-independent protein translocase protein TatE (tatE) from Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCDC 279-56)

KEGG orthology group: K03425, sec-independent protein translocase protein TatE (inferred from 97% identity to enc:ECL_03068)

MetaCyc: 91% identical to twin arginine protein translocation system - TatE protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatE" in subsystem Twin-arginine translocation system

Protein Sequence (67 amino acids)

>EX28DRAFT_2336 twin arginine-targeting protein translocase, TatA/E family (Enterobacter asburiae PDN3)
MGEISITKLLVVAALVVLLFGTKKLRTLGGDLGAAIKGFKKAMNDDDAAAKKSAEDDVPA
DKLSHKE