Protein Info for EX28DRAFT_2325 in Enterobacter asburiae PDN3

Annotation: nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 TIGR00125: cytidyltransferase-like domain" amino acids 6 to 68 (63 residues), 43.8 bits, see alignment E=2.2e-15 PF01467: CTP_transf_like" amino acids 7 to 187 (181 residues), 104 bits, see alignment E=3.8e-34 TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase" amino acids 7 to 212 (206 residues), 192.2 bits, see alignment E=9.9e-61

Best Hits

Swiss-Prot: 80% identical to NADD_ECO57: Nicotinate-nucleotide adenylyltransferase (nadD) from Escherichia coli O157:H7

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 94% identity to enc:ECL_03057)

MetaCyc: 80% identical to nicotinate-nucleotide adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide adenylyltransferase. [EC: 2.7.7.18]

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>EX28DRAFT_2325 nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18) (Enterobacter asburiae PDN3)
MHSLQALYGGTFDPVHYGHLKPVEILANLIGLQRVTIMPNNVPPHRPQPEATSEQRKEML
ALAIADKPLFRLDERELRRETPSWTSQTLQEWRAEQGPDQPLAFIIGQDSLLNFPTWHQY
ETILENSHLLVCRRPGYPLTMREEQYQQWLEDHLTDNVEDLHNQPAGKIYLAETPWFDIS
ATLIRERLQQGLACDDLLPTPVLAYIRAHGLYQKSADE