Protein Info for EX28DRAFT_2320 in Enterobacter asburiae PDN3

Annotation: Inosine-uridine nucleoside N-ribohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01156: IU_nuc_hydro
  • amino acids 5 to 300 (296 residues), 353.4 bits, E=6.7e-110

Best Hits

Swiss-Prot: 90% identical to RIHA_ENT38: Pyrimidine-specific ribonucleoside hydrolase RihA (rihA) from Enterobacter sp. (strain 638)

KEGG orthology group: K01250, pyrimidine-specific ribonucleoside hydrolase [EC: 3.2.-.-] (inferred from 94% identity to enc:ECL_03052)

MetaCyc: 86% identical to pyrimidine-specific ribonucleoside hydrolase RihA (Escherichia coli K-12 substr. MG1655)
Uridine nucleosidase. [EC: 3.2.2.3]; 3.2.2.3 [EC: 3.2.2.3]

Predicted SEED Role

"Inosine-uridine preferring nucleoside hydrolase (EC 3.2.2.1)" in subsystem Purine conversions or Queuosine-Archaeosine Biosynthesis (EC 3.2.2.1)

MetaCyc Pathways

• superpathway of pyrimidine ribonucleosides salvage (10/10 steps found)
• adenine and adenosine salvage II (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• pyrimidine ribonucleosides salvage II (2/2 steps found)
• pyrimidine ribonucleosides salvage III (2/2 steps found)
• guanosine nucleotides degradation II (3/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (4/6 steps found)
• purine nucleotides degradation I (plants) (8/12 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• superpathway of purines degradation in plants (11/18 steps found)
• NAD salvage (plants) (5/11 steps found)

KEGG Metabolic Maps

• Glycosaminoglycan degradation
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.2.-.-

Use Curated BLAST to search for 3.2.-.- or 3.2.2.1 or 3.2.2.3

Protein Sequence (313 amino acids)

>EX28DRAFT_2320 Inosine-uridine nucleoside N-ribohydrolase (Enterobacter asburiae PDN3)
MGQPIILDCDPGHDDAIALVLALASPELEVKAVTSSAGNQTPDKTLRNVLRMLTLLKRTD
IPVAGGAVKPLMRELIIADSVHGESGLDGPALPEPGFTPQNCTAVELMAKVLRESAEPVT
LVATGPQTNIALLLNSHPELHNKIARIVIMGGAMGLGNWTPAAEFNIFVDPEAAEIVFQS
GLPIVMAGLDVTHRAQIMADDIERFRSVGNPVATTVAELLDFFMEYHKAEKWGFHGAPLH
DPCTIAWLLKPAMFTTVDRWVGVETQGKYTQGMTVVDYYSLTGNKANTTVMVDIDREAFV
DLLAERLAYYSAA