Protein Info for EX28DRAFT_2313 in Enterobacter asburiae PDN3

Annotation: Putative Mg2+ and Co2+ transporter CorC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF00571: CBS" amino acids 84 to 139 (56 residues), 35.5 bits, see alignment E=1e-12 amino acids 155 to 204 (50 residues), 27.4 bits, see alignment 3.5e-10 PF03471: CorC_HlyC" amino acids 221 to 296 (76 residues), 82.5 bits, see alignment E=1.7e-27

Best Hits

Swiss-Prot: 94% identical to CORC_ECOL6: Magnesium and cobalt efflux protein CorC (corC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06189, magnesium and cobalt transporter (inferred from 99% identity to enc:ECL_03046)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>EX28DRAFT_2313 Putative Mg2+ and Co2+ transporter CorC (Enterobacter asburiae PDN3)
MAVNVELTREPLTNAMSDDNSHSSDTTTSKKGFFSLILNQLFHGEPKNRDELLELIRDSG
QNDLIDEDTREMLEGVMDIADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFPV
ISEDKDHIEGILMAKDLLPFMRSDAEAFSMEKVLRQAVVVPESKRVDRMLKEFRSQRYHM
AIVIDEFGGVSGLVTIEDILELIVGEIEDEYDEEEDIDFRQLSRHTWTVRALASIEDFND
AFGTHFSDEEVDTIGGLVMQAFGHLPARGETVDIDGYQFKVAMADSRRIIQVHVRTPDDS
PVPKLED