Protein Info for EX28DRAFT_2311 in Enterobacter asburiae PDN3

Annotation: Phosphate starvation-inducible protein PhoH, predicted ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF02562: PhoH" amino acids 118 to 321 (204 residues), 326.8 bits, see alignment E=7.2e-102 PF13604: AAA_30" amino acids 123 to 274 (152 residues), 31.2 bits, see alignment E=2.7e-11 PF13245: AAA_19" amino acids 126 to 274 (149 residues), 28 bits, see alignment E=3.4e-10

Best Hits

Swiss-Prot: 96% identical to PHOL_ECOLI: PhoH-like protein (ybeZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_13950)

Predicted SEED Role

"Phosphate starvation-inducible protein PhoH, predicted ATPase" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>EX28DRAFT_2311 Phosphate starvation-inducible protein PhoH, predicted ATPase (Enterobacter asburiae PDN3)
MNIDTREISLEPADNARLLSLCGPFDDNIKQLERRLGIEINRRDNHFKLTGRPICVNAAA
DILRSLYVDTSPMRGEIQDIEPEQIHLAIKEARVLEQSAESVPDYGKAINIKTKRGVIKP
RTPNQAQYIANILDHDITFGVGPAGTGKTYLAVAAAVDALERQDIRRILLTRPAVEAGEK
LGFLPGDLSQKVDPYLRPLYDALFEMLGFEKVEKLIERNVIEVAPLAYMRGRTLNDAFII
LDESQNTTIEQMKMFLTRIGFNSKAVITGDVTQIDLPRSTKSGLRHAIEVLAEVDEISFN
FFHSEDVVRHPVVARIVNAYEAWEEADQKRKAELAAERKREAQEQEQK