Protein Info for EX28DRAFT_2300 in Enterobacter asburiae PDN3

Annotation: Predicted sugar phosphatases of the HAD superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00702: Hydrolase" amino acids 3 to 214 (212 residues), 63.2 bits, see alignment E=9.1e-21 PF13344: Hydrolase_6" amino acids 6 to 105 (100 residues), 85.8 bits, see alignment E=3.6e-28 TIGR01460: HAD hydrolase, family IIA" amino acids 6 to 223 (218 residues), 218.2 bits, see alignment E=1.5e-68 PF13419: HAD_2" amino acids 164 to 220 (57 residues), 33 bits, see alignment E=1.2e-11 PF13242: Hydrolase_like" amino acids 174 to 246 (73 residues), 79.4 bits, see alignment E=3e-26

Best Hits

Swiss-Prot: 95% identical to NAGD_ECOLI: Ribonucleotide monophosphatase NagD (nagD) from Escherichia coli (strain K12)

KEGG orthology group: K02566, NagD protein (inferred from 99% identity to enc:ECL_03040)

MetaCyc: 95% identical to UMP phosphatase (Escherichia coli K-12 substr. MG1655)
5'-nucleotidase. [EC: 3.1.3.5]

Predicted SEED Role

"Phosphatase NagD predicted to act in N-acetylglucosamine utilization subsystem" in subsystem Chitin and N-acetylglucosamine utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>EX28DRAFT_2300 Predicted sugar phosphatases of the HAD superfamily (Enterobacter asburiae PDN3)
MTIKNVICDIDGVLMHDNVAVPGAAEFLHRIIDKGMPLVLLTNYPSQTGQDLANRFATAG
VNVPDSVFYTSAMATADFLKRQEGKKAYVVGEGALIHELYKAGFTITDVNPDFVIVGETR
SFNWEMMHKAAYFVASGARFIATNPDTHGRGFYPACGALCAGIEKISGRQPFVVGKPSPW
IIRAALNKMQAHSEETVIVGDNLRTDILAGFQAGLETILVLSGVSQLDDIDSMPFRPSWI
YPSVDEIDII