Protein Info for EX28DRAFT_2296 in Enterobacter asburiae PDN3

Annotation: PTS system, N-acetylglucosamine-specific IIBC component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 33 to 57 (25 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 321 to 338 (18 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details PF02378: PTS_EIIC" amino acids 1 to 310 (310 residues), 246.4 bits, see alignment E=5.9e-77 TIGR01998: PTS system, N-acetylglucosamine-specific IIBC component" amino acids 1 to 476 (476 residues), 653.7 bits, see alignment E=2.5e-200 TIGR00826: PTS system, glucose-like IIB component" amino acids 369 to 465 (97 residues), 66.4 bits, see alignment E=3.3e-22 PF00367: PTS_EIIB" amino acids 408 to 440 (33 residues), 51.4 bits, see alignment (E = 8.7e-18) PF00358: PTS_EIIA_1" amino acids 511 to 634 (124 residues), 157.5 bits, see alignment E=2.1e-50 TIGR00830: PTS system, glucose subfamily, IIA component" amino acids 511 to 631 (121 residues), 157.1 bits, see alignment E=2.7e-50

Best Hits

KEGG orthology group: K02802, PTS system, N-acetylglucosamine-specific IIA component [EC: 2.7.1.69] K02803, PTS system, N-acetylglucosamine-specific IIB component [EC: 2.7.1.69] K02804, PTS system, N-acetylglucosamine-specific IIC component (inferred from 95% identity to esc:Entcl_3136)

Predicted SEED Role

"PTS system, N-acetylglucosamine-specific IIA component / PTS system, N-acetylglucosamine-specific IIB component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIC component" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (659 amino acids)

>EX28DRAFT_2296 PTS system, N-acetylglucosamine-specific IIBC component (Enterobacter asburiae PDN3)
MVPVATLPAAAILMGVGYWIDPNGWGNTSALAAFFIKSGSAIIDNMSVLFAIGVAYGMSK
DKDGAAALTGFVGFLVLTTLCSPAAVAMIQKIPADQVPAAFGKISNQFVGILVGIISAEL
YNRFSSVELPKALSFFSGRRLVPILTSFVMIVVAFIMMYVWPMIFDGLVNFGEHIQKLGS
VGAGVYAFFNRLLIPVGLHHALNSVFWFDVAGINDIPNFLGGAQSIEAGKAVVGITGRYQ
AGFFPIMMFGLPGAALAIYHCARPENKAKVLGIMMAGAFAAFFTGITEPLEFSFMFVAPV
LYVIHAVLTGISVFIAASMHWIAGFGFSAGLVDMVLSSRNPLATHWWMLIPQGLVFFAIY
YMVFRFTITKFNLMTPGRELAVAGSEADGQDVNVSGAQDQDVSGLARQYIAAVGGSDNLT
GIDACITRLRLNVKDSSLVNEALAKRLGASGVIRLNKTSVQIIVGFVAEKIANAMKTTGP
VAAAEASAAPAAAPAAAKPQAVPNAKTVAALVSPVTGEVVAIEQVPDEAFASKAVGDGVA
VKPTEKTVVSPAAGTIVKIFNTNHAFCLETENGAEIVVHMGIDTVALNGQGFTRLVEEGA
EVVAGQPILEMDLDFLNANARSMISPVVCSNIDDFSGLVIQAKGQVVAGQTPLYEIKGK