Protein Info for EX28DRAFT_2293 in Enterobacter asburiae PDN3

Annotation: YbfN-like lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13982: YbfN" amino acids 22 to 108 (87 residues), 158.7 bits, see alignment E=1.8e-51

Best Hits

Swiss-Prot: 74% identical to CHIQ_ECOLI: Uncharacterized lipoprotein ChiQ (chiQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to enc:ECL_03033)

Predicted SEED Role

"Hypothetical lipoprotein ybfN precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>EX28DRAFT_2293 YbfN-like lipoprotein (Enterobacter asburiae PDN3)
MMKKIVIVALLASGLVACAQTQAPKEDTRLKEAYSACINTAEGSPEKIEACQSVLNVLKK
EKAHEQFATQENVRVMDYQACIQARKTGNDQEVAKRCDKIWNEIRNNNK