Protein Info for EX28DRAFT_2291 in Enterobacter asburiae PDN3

Annotation: flavodoxin, long chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01752: flavodoxin
  • amino acids 4 to 169 (166 residues), 254.3 bits, E=2e-80
• PF12724: Flavodoxin_5
  • amino acids 6 to 89 (84 residues), 31.8 bits, E=2.5e-11
• PF12641: Flavodoxin_3
  • amino acids 6 to 122 (117 residues), 40.6 bits, E=3.5e-14
• PF00258: Flavodoxin_1
  • amino acids 6 to 160 (155 residues), 106.2 bits, E=2.5e-34

Best Hits

Swiss-Prot: 95% identical to FLAV_SALTY: Flavodoxin 1 (fldA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03839, flavodoxin I (inferred from 99% identity to enc:ECL_03031)

MetaCyc: 95% identical to flavodoxin A (Salmonella enterica enterica serovar Typhimurium)
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]

Predicted SEED Role

"Flavodoxin 1" in subsystem Flavodoxin

MetaCyc Pathways

• adenosylcobalamin salvage from cobalamin (5/5 steps found)
• adenosylcobinamide-GDP salvage from cobinamide I (4/5 steps found)
• adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (3/6 steps found)
• adenosylcobinamide-GDP salvage from cobinamide II (3/6 steps found)
• cobalamin salvage (eukaryotic) (4/8 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide I (4/8 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (3/9 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (13/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (12/36 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Protein Sequence (176 amino acids)

>EX28DRAFT_2291 flavodoxin, long chain (Enterobacter asburiae PDN3)
MAIIGIFFGSDTGNTENIAKNIQKQLGKDVADVHDIAKSSKEDLEGYDILLLGIPTWYYG
EAQCDWDDFFPTLEEVDFNGKLVALFGCGDQEDYAEYFCDALGTIRDIIEPNGAVIVGHW
PTAGYHFEASKGLADDNHFVGLAIDEDRQPELTAERVEKWVKQIREELHLDDILNA