Protein Info for EX28DRAFT_2288 in Enterobacter asburiae PDN3

Annotation: negative regulator of replication initiation SeqA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF17206: SeqA_N" amino acids 1 to 36 (36 residues), 78.6 bits, see alignment 1.7e-26 PF03925: SeqA" amino acids 72 to 180 (109 residues), 169.4 bits, see alignment E=2.4e-54

Best Hits

Swiss-Prot: 86% identical to SEQA_ECOL6: Negative modulator of initiation of replication (seqA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03645, negative modulator of initiation of replication (inferred from 96% identity to enc:ECL_03028)

Predicted SEED Role

"SeqA protein, negative modulator of initiation of replication"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>EX28DRAFT_2288 negative regulator of replication initiation SeqA (Enterobacter asburiae PDN3)
MKTIEVDDELYQYIASQTRHIGESASDILRRMLKISAASQPATPATKDVVSQPSVVAQAK
PAVTPAKDKVRAMRELLLSDEYAEQKKAVNRFMLVLSTLYSLDNKAFAEATESLHGRTRV
YFAGDEQTLLQNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCG
TI