Protein Info for EX28DRAFT_2243 in Enterobacter asburiae PDN3

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 81 to 105 (25 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 154 to 180 (27 residues), see Phobius details amino acids 186 to 203 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 16 to 291 (276 residues), 329.3 bits, see alignment E=9.9e-103 PF01545: Cation_efflux" amino acids 19 to 211 (193 residues), 174.1 bits, see alignment E=1.5e-55

Best Hits

Swiss-Prot: 80% identical to ZITB_ECO57: Zinc transporter ZitB (zitB) from Escherichia coli O157:H7

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 94% identity to enc:ECL_02985)

MetaCyc: 80% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Zinc transporter ZitB" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>EX28DRAFT_2243 cation diffusion facilitator family transporter (Enterobacter asburiae PDN3)
MAHSHSHSHSPGNDNAKRLMLAFGVTATFMVIEVIGGLISGSLALLADAGHMLTDAAALL
FALLAVQFARRPPNARHTFGWLRLTTLAAFVNAIALVVITVLIVWEAVQRFRHPQPIAGA
TMMVIAVAGLLANILAFWILHRGSGEKNLNVRAAALHVLGDLLGSVGAIVAALVILYTGW
TPVDPILSVLVSCLVLRSAWRLLKESVNELLEGAPASMDIDELKRNLRRSVPEVRNVHHV
HVWLVGEKPVMTLHVQVIPPHDHDALLERIQHFLEHHYEIGHVTIQMEYQPCNGPDCHLN
EAQSGHSHQHHH